SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|258650292|ref|YP_003199448.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258650292|ref|YP_003199448.1|
Domain Number 1 Region: 5-369
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 6.02e-67
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|258650292|ref|YP_003199448.1|
Sequence length 371
Comment hypothetical protein Namu_0021 [Nakamurella multipartita DSM 44233]
Sequence
MTGVRVLVGTRKGAFVLTADGSRRDWQVSGPHFAGWEIYHVAGSPAEPNRLYASQSSGWF
GQVVQRSDDGGRTWAPQPGTFSYEGEVGPHQYYDGTPRPWSFTRVWHFEPTREDPDTVYA
GVEDAALFRTTDGGASWQELPALRQHRTGPDWAPGAGGMCLHTIILDPKKADRIYAAISA
AGVFRSDDAGASWRPINQGLHSEGIPDQQAEVGHCVHHVAQHPDRPDVLYMQKHWDVMRS
NDSGESWTEISGNLPTDFGFPIAVHAHEPDTVYVLPITSDANHVVMDGKLRVYRSRTGGH
EWEPLTAGLPQQNCYVNVLRDAMAVDTLDECGLYFGTTGGQVYASADSGDSWAPIVRDLP
AVLSVEVQTLP
Download sequence
Identical sequences C8XHW8
WP_012813934.1.85990 gi|258650292|ref|YP_003199448.1| 479431.Namu_0021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]