SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|258651981|ref|YP_003201137.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258651981|ref|YP_003201137.1|
Domain Number 1 Region: 15-83
Classification Level Classification E-value
Superfamily Homeodomain-like 7.7e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0054
Further Details:      
 
Weak hits

Sequence:  gi|258651981|ref|YP_003201137.1|
Domain Number - Region: 111-182
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00271
Family Tetracyclin repressor-like, C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|258651981|ref|YP_003201137.1|
Sequence length 232
Comment TetR family transcriptional regulator [Nakamurella multipartita DSM 44233]
Sequence
MRIVPGSHDRPAADLTARAKVRDAAIAAFAEQGFDASFRVIAARAGVSPGLITHHFGSKE
QLRAECDAEVLRQYRALKSSSIANPSGYLFQHLAEPGPAAQLTVYMLRAIHAGGRPAQDF
LEHLIDGAREVMAASVAAGLVRPSRDEEARTRYLAFQTMGAMLIQFLTMPDPSPEAFVES
IRNSRQNQILPTLELFTDGLLVDRSMLEDYLGYLERAPDTATAAGDPDSRTA
Download sequence
Identical sequences C8XGG5
479431.Namu_1758 gi|258651981|ref|YP_003201137.1| WP_015747051.1.85990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]