SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|258652016|ref|YP_003201172.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258652016|ref|YP_003201172.1|
Domain Number 1 Region: 125-272
Classification Level Classification E-value
Superfamily Sortase 0.00000000000294
Family Sortase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|258652016|ref|YP_003201172.1|
Sequence length 276
Comment peptidase C60 sortase A and B [Nakamurella multipartita DSM 44233]
Sequence
MAGDAGRSGQGPIARRRPAPRSILIAVVGIVLLLGGGAALTVGLLSQQSAPNPAASAPAP
SPTRSPAPTTSSPSAVPSTVVGSPGSGSANTAPPTTVSGIPTATAQPSQPPEQSAAAPAP
SAPAAARPIHLRIPAIEVDTELIELGLAPDGSLAVPAPGPDYDKAAWFNGSPAPGDVGPA
VLEGHIDSAANGPSVFFELAALTAGDQVFVDRADGSTVSFTVDTVASYPKSDFPTLQVYR
NTSGPELRLITCGGDFDSGAGSYLNNTVVYAHQNEG
Download sequence
Identical sequences C8XGK0
WP_015747085.1.85990 gi|258652016|ref|YP_003201172.1| 479431.Namu_1793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]