SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|258652520|ref|YP_003201676.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258652520|ref|YP_003201676.1|
Domain Number 1 Region: 77-139
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000667
Family NfeD domain-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|258652520|ref|YP_003201676.1|
Sequence length 143
Comment hypothetical protein Namu_2311 [Nakamurella multipartita DSM 44233]
Sequence
MSAWIWLVGGVLLSIAEVLGAEFVLLMLGGGALITAGFAAFFPELLWLQVLVFALSSVAL
VLGLRPMLLRRYYQPSQTRTGIDAIIGSKATVVSTVDADGGQVKIGGEVWSAVSLDGHRA
LPPGTSVTVVEVRGATAVVIWGA
Download sequence
Identical sequences C8XKC5
gi|258652520|ref|YP_003201676.1| WP_015747577.1.85990 479431.Namu_2311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]