SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|258654769|ref|YP_003203925.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|258654769|ref|YP_003203925.1|
Domain Number - Region: 125-250
Classification Level Classification E-value
Superfamily Sortase 0.0318
Family Sortase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|258654769|ref|YP_003203925.1|
Sequence length 267
Comment peptidase C60 sortase A and B [Nakamurella multipartita DSM 44233]
Sequence
MTPVASEQGARPPGDQRPDHSRRRAATSLAAGVLLILAAGLLWWVSRPEPAGQTVSSVGA
SGALELTGPTSAGSASPVEPIAPAEPTEPAAPSAPPSPAAAPAAPPADQPAPAAAPDPVI
ADPTRLQIPALAVDAPVEPVGVADDGEIEVPGDVATVGWYRFGPAPGATGSAVLVGHVDD
YRQGAGVLARIGDLNPGDTIAVAGPDGTVRQFSVVAREQWAKADTPLDRLFDRGGEARLV
LITCGGRFDQASLSYDDNIAVTAVPVA
Download sequence
Identical sequences C8X7T3
WP_015749750.1.85990 479431.Namu_4659 gi|258654769|ref|YP_003203925.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]