SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|258655072|ref|YP_003204228.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258655072|ref|YP_003204228.1|
Domain Number 1 Region: 12-270
Classification Level Classification E-value
Superfamily Cgl1923-like 1.19e-79
Family Cgl1923-like 0.00000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|258655072|ref|YP_003204228.1|
Sequence length 304
Comment hypothetical protein Namu_4966 [Nakamurella multipartita DSM 44233]
Sequence
MGSEPGELYELHLERDEIELLNEPVLLVALDGYIDAGSGVRLAVEHLLAAQPHTVIATFD
IDQLIDYRARRPILTYQQNAFTDYQQPELQVRVLTDTDGTAFLLLSGPEPDTQWERFIAA
VGQIADRFAVRLTVGLMAIPMGVPHTRPTGMSSHATRTGLLPDQEDWLGVIQVPGHAVGL
MEYRFGQAGRDAIGFAAHVPHYIARSDYPETARTLIQATADATGLLLPTRGLDEAAAKVQ
AELAKQIQDNAEVAEVVKGLEQQYDAYVSATGQSLLAQSAPLPTADELGAQFEAFLADRE
PPTS
Download sequence
Identical sequences C8XA39
479431.Namu_4966 WP_015750047.1.85990 gi|258655072|ref|YP_003204228.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]