SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|258655323|ref|YP_003204479.1| from Nakamurella multipartita DSM 44233

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258655323|ref|YP_003204479.1|
Domain Number 1 Region: 106-235
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.12e-21
Family GntR ligand-binding domain-like 0.0091
Further Details:      
 
Domain Number 2 Region: 8-90
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.78e-19
Family GntR-like transcriptional regulators 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|258655323|ref|YP_003204479.1|
Sequence length 244
Comment GntR family transcriptional regulator [Nakamurella multipartita DSM 44233]
Sequence
MAAPAGWEPVQRVPTYELVLRRIEEQLINRTLRPGDRLPPERELATMLGASRPAVREALR
VLQAQGVVRSAVGTGADSGTIVTQAPSGALTRLLRVHLAVASFPLSDVVESRVMFERFSA
LGAAKAMTPEVLARIEKPLLAMDEPDIERARFNELDTEFHVAIAEAGGNQFIADLTVAVR
ESIRSDILGTLEQAGDWPEIRDGLRADHHAIYQALATADGPGAADALERHIEGFYVRMKV
GVSG
Download sequence
Identical sequences C8XC96
479431.Namu_5224 WP_015750296.1.85990 gi|258655323|ref|YP_003204479.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]