SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256832428|ref|YP_003161155.1| from Jonesia denitrificans DSM 20603

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256832428|ref|YP_003161155.1|
Domain Number 1 Region: 24-272
Classification Level Classification E-value
Superfamily Cgl1923-like 6.41e-72
Family Cgl1923-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256832428|ref|YP_003161155.1|
Sequence length 296
Comment hypothetical protein Jden_1196 [Jonesia denitrificans DSM 20603]
Sequence
MERDEGHLDASRGDEEDAVWALSHDTVLIAAFSGWNDAGGAATGATEHIAEVFGCDVVAD
IDPDEFVDFQVNRPVVDGVGVDRRLVWPGTQISMAYSWNSQRRIVVAHGVEPSFRWRSFT
AELLTVAESFGVKTIIVVGALLGDTPHSRPIPVQVSTSDAGVQEFLGTGDSEYEGPTGIV
GVISQIAPDAGFTVLSVWGAVPHYVPSSPSPKATAALVSKIEELLGEPITRYDLDDEAKA
WEDGVSELAESDPQIAQYVRELEEVRDATQLPNASGEAIAREFEQYLRRRGQSPAD
Download sequence
Identical sequences C7R3Z5
gi|256832428|ref|YP_003161155.1| WP_015771480.1.34072 WP_015771480.1.39474 471856.Jden_1196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]