SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|238027849|ref|YP_002912080.1| from Burkholderia glumae BGR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238027849|ref|YP_002912080.1|
Domain Number 1 Region: 195-368
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.44e-44
Family Histidine kinase 0.0033
Further Details:      
 
Domain Number 2 Region: 383-507
Classification Level Classification E-value
Superfamily CheY-like 1.57e-29
Family CheY-related 0.015
Further Details:      
 
Domain Number 3 Region: 6-134
Classification Level Classification E-value
Superfamily CheY-like 3.27e-29
Family CheY-related 0.0016
Further Details:      
 
Domain Number 4 Region: 125-207
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 8.04e-17
Family Homodimeric domain of signal transducing histidine kinase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238027849|ref|YP_002912080.1|
Sequence length 648
Comment histidine kinase [Burkholderia glumae BGR1]
Sequence
MAALSPLILNVDDNEGARYAKTRVLIHAGYQVIEAGTGQDALDLVEARRPALVLLDVRLP
DISGIDVCSQIKRDARTRSTLVLQTSAAAVQSLDKVRALDGGADSYLTEPIAPAELVANV
RALLRLHRAEEALRDADRRKDQFLATLAHELRNPLAPIRNAIELMDPKYQAAEALVHDAR
MIARRQVDHLSRLVDDLLDVSRITHGKIALRMEPVDIEAAVAAAVETSQPAMERKHHVLR
VSMPPLPCVVNGDAIRISQVIANLLSNAAKYTPDGGRIELGVAVAPGAVEISVADNGIGI
APAELDEVFNLFMQSADSVKRSEGGLGIGLSLARTLTELHGGTIVASSDGIGHGSRFVVR
LPLAVPDPAAAGPAAADAAPRPQRRVMVVDDSVDGAESMSVLLRILGHEVRTLYEGTSAI
AAAAAFQPEVVMLDIGLPGMDGYEIARALRALPATAGALLIALTGYGQESDRQRTRAAGF
DHHLVKPATLEDIERAIATVGTDAAARRHRAGQPGRLARQRAAPARGPERAAEASHLSGR
TPASDGPPARPEPTSRSAAPASPAPTLARGPGAAPANRPARRRDGRATPRHAFHCLAAPR
PQAAAGAAAPGSGTSVAACSVSLGIAIPACVHQQERRHVRQHGSNHDA
Download sequence
Identical sequences C5A8M8
gi|238027849|ref|YP_002912080.1| WP_015876255.1.99142 626418.bglu_1g22800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]