SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146291894|ref|YP_001182318.1| from Shewanella putrefaciens CN-32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146291894|ref|YP_001182318.1|
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.7e-45
Family SMI1/KNR4-like 0.00000534
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146291894|ref|YP_001182318.1|
Sequence length 135
Comment hypothetical protein Sputcn32_0789 [Shewanella putrefaciens CN-32]
Sequence
MHDIIEQLQERSESVPVPLELPTFEQLVEVEEQILISLPRELKEYLLYASDVIYGAIEPV
TVADPYSHTYLPEVTCYAWSIGMPRDMIAICQMGDDFYCIDQEGQVHFWKNGDFADIYWE
SFWEWVEDIWLKNKY
Download sequence
Identical sequences A4Y3I6 E6XKE0
gi|120600178|ref|YP_964752.1| WP_011790641.1.65999 WP_011790641.1.82224 WP_011790641.1.85280 WP_011790641.1.98421 gi|146291894|ref|YP_001182318.1| 319224.Sputcn32_0789 351745.Sputw3181_3386 gi|386312560|ref|YP_006008725.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]