SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146292024|ref|YP_001182448.1| from Shewanella putrefaciens CN-32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146292024|ref|YP_001182448.1|
Domain Number 1 Region: 3-66,103-150
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000301
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146292024|ref|YP_001182448.1|
Sequence length 153
Comment hypothetical protein Sputcn32_0920 [Shewanella putrefaciens CN-32]
Sequence
MKILELQIERGIELPSDYLEFVAGIDAGEDYCFNEYPDEYHEFKGRCWAFFDEELLCENI
KMSGVGNAPAHRQLELYLKCYQEFSNSEFVHSSEGKLPINRVANGFVVAEENGDLLYLDP
EDNFSVWIFHHDGSDVKKVSNSMSEWLARTTNA
Download sequence
Identical sequences A4Y3W6
gi|146292024|ref|YP_001182448.1| 319224.Sputcn32_0920 WP_011918773.1.82224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]