SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146294045|ref|YP_001184469.1| from Shewanella putrefaciens CN-32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146294045|ref|YP_001184469.1|
Domain Number 1 Region: 3-66,103-150
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000288
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146294045|ref|YP_001184469.1|
Sequence length 153
Comment hypothetical protein Sputcn32_2955 [Shewanella putrefaciens CN-32]
Sequence
MKILELQIERGIELPSDYLEFVAGIDAGEDYCFNEYLDEYPEFKGRCWAFFDEELLCENI
KMSGVGNAPAHRQLELYLKCYQEFSNSEFVHSSEGKLPINRVANGFVVAEENGDLLYLDP
EDNFSVWIFHHDGSDVKKVSNSMSEWLARTTNA
Download sequence
Identical sequences A4Y9N7
WP_011919829.1.82224 319224.Sputcn32_2955 gi|146294045|ref|YP_001184469.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]