SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146294202|ref|YP_001184626.1| from Shewanella putrefaciens CN-32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146294202|ref|YP_001184626.1|
Domain Number 1 Region: 3-66,103-149
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000157
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146294202|ref|YP_001184626.1|
Sequence length 153
Comment hypothetical protein Sputcn32_3115 [Shewanella putrefaciens CN-32]
Sequence
MKISELQKERGIELPSDYLEFVAGIDAGEDYCFNKFPDEYPDFEGRCWAFFDEELLCENI
EMSGVGNAPAHRQLELYLKCYREFSNSEFVHSSEGKLPINRVANGFVVAEENGDLLYLDP
EDNFSVWIFHHDGSDVKKVSNSMSEWLARTTTA
Download sequence
Identical sequences A4YA44 E6XM69
319224.Sputcn32_3115 gi|146294202|ref|YP_001184626.1| gi|386314921|ref|YP_006011086.1| WP_011919918.1.82224 WP_011919918.1.85280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]