SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146294291|ref|YP_001184715.1| from Shewanella putrefaciens CN-32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146294291|ref|YP_001184715.1|
Domain Number 1 Region: 31-157
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000133
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146294291|ref|YP_001184715.1|
Sequence length 176
Comment hypothetical protein Sputcn32_3204 [Shewanella putrefaciens CN-32]
Sequence
MTLSVLNSILVPPNIPNESGIGNVWPSIDEGLSFPSDYIAFINRYGTGRIADFIAIFNPF
TTNCDLDFFEQKKSIIEDFNYLNNEDPEYFKYNLYPEINGLLPIGVTDNGDCIFWVVSDL
KDSDTWGTAIIASRSPDVEYFDENITSLLSGLLLRKIRSGSLPNSFPPKNIAFEKI
Download sequence
Identical sequences A4YAD3
gi|146294291|ref|YP_001184715.1| 319224.Sputcn32_3204 WP_011919947.1.82224 2005424909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]