SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146294656|ref|YP_001185080.1| from Shewanella putrefaciens CN-32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146294656|ref|YP_001185080.1|
Domain Number 1 Region: 21-168
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000275
Family SMI1/KNR4-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146294656|ref|YP_001185080.1|
Sequence length 183
Comment hypothetical protein Sputcn32_3572 [Shewanella putrefaciens CN-32]
Sequence
MDVKTYLQALSALYASLNQTLELHHGLSNSALDEAEKQLGFTLISPLRELWGYANGGNEW
STVFARKDYFCRYDFLSLASSLKFRDRMKKQAQYYADYQEPEVRDPKIQSGWYQEGWLPF
AQFGGGTLLLIADHSPSALGQIGQVIAYTHDPDMMDFICPDLSQFFAQSLAQIALYPDEL
IED
Download sequence
Identical sequences A4YBE8
gi|146294656|ref|YP_001185080.1| WP_011920114.1.82224 319224.Sputcn32_3572 368369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]