SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|110835572|ref|YP_694431.1| from Alcanivorax borkumensis SK2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110835572|ref|YP_694431.1|
Domain Number 1 Region: 4-127
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.88e-23
Family SMI1/KNR4-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110835572|ref|YP_694431.1|
Sequence length 132
Comment hypothetical protein ABO_2711 [Alcanivorax borkumensis SK2]
Sequence
MAFPVDEKYIENTKNELGVKFPDSFRKKMMKSNGGGVEVSTDYFEIHPFYDTSDKKRIKR
TCNSILHETKIAREHYRLPENLIVIGNNGGGDVLVYKTEKEGSINNAVYWLDHETEELVL
AAKDFGELNQSV
Download sequence
Identical sequences Q0VKY9
WP_011589982.1.14994 393595.ABO_2711 gi|110835572|ref|YP_694431.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]