SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390961877|ref|YP_006425711.1| from Thermococcus sp. CL1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390961877|ref|YP_006425711.1|
Domain Number 1 Region: 669-906
Classification Level Classification E-value
Superfamily PP2C-like 3.01e-65
Family PP2C-like 0.00000686
Further Details:      
 
Weak hits

Sequence:  gi|390961877|ref|YP_006425711.1|
Domain Number - Region: 491-630
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00575
Family HBL-like 0.097
Further Details:      
 
Domain Number - Region: 425-475
Classification Level Classification E-value
Superfamily Tropomyosin 0.0785
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390961877|ref|YP_006425711.1|
Sequence length 909
Comment putative Serine/threonine protein phosphatase [Thermococcus sp. CL1]
Sequence
MVSLRRVVSILLLIIMVLSVPVTAADTGQTTQDSTQQASSDVEGINKDIDLANQTLKTLN
ENKEALDVPPEEIKKLNQSITTAKEQLNNGDSEGANATLINGFWNPLAELLTNITTDLNT
EYTQLSKDAKACSDKTAAEEIKSDLNGVKSLLDRARELINEGSKDHSKFADAITTLLEAR
KKLDTAKGETEKCLVPLEEVEGKIDSAESALRAIKDNREFLNVDNKTITDLESEIEKARA
QLEAGNVSEANATISEVMSRMREIIQAKLDALSEKYREYDDYFKKYCTGTTDQKTLEEAL
KTVNQQLAIAKENLSGNRMPEAVSHLKSASGTLENVKKPLAECLVGKADETVKNITVKYN
ALPQDYYDVIIKPLESKLKKAKTALSGGDYDNAISLAVEVINNGDFKVIRERILEQMMAR
LGVKEINMTEENLNDLEKRYEQVQKRLQEARKKKPAISIISADDKLKRAEEELNKVNAAL
MIIRAYLKAQNAQGAEDLLGAVNEFNSALSASGGAESYIVASVAQVESLLNDASKSIDDA
ESSYTWNTVLLAVIALLLLAGLGYGGYIGYTKYQDKKRVDEAREAVETMEDIIESLRSEL
ASLNLLEDKGVKKKLDEMGRLVSEARAAFERGDYRRPIVLKEKFVSEYDRLKLRIAPYKQ
TLGVDVTKHVAAKSYIGRRQNNEDAYIVEKIGGNILLAVADGMGGHLAGEVASRKAIEIL
KETLENNKFEDPEEVFRKAIQRANEVIYQMGHDPAHPEWYNMGTTLTAAIVRGNEATIAN
IGDSRTYLIRPDGSIKRLTKDHSLVQELIDKGEITPEEARKHPQKNVITKALGISQTINI
DRNDIKKVSLQKGDHLLLCSDGLSDALPDSEIARTVLAAPSLEEAVKILVEKAYGYGSDD
NITVVLYRH
Download sequence
Identical sequences I3ZW33
gi|390961877|ref|YP_006425711.1| WP_014789548.1.33015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]