SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390961880|ref|YP_006425714.1| from Thermococcus sp. CL1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390961880|ref|YP_006425714.1|
Domain Number 1 Region: 16-246
Classification Level Classification E-value
Superfamily PP2C-like 1.31e-57
Family PP2C-like 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|390961880|ref|YP_006425714.1|
Sequence length 248
Comment putative Protein phosphatase 2C-like protein [Thermococcus sp. CL1]
Sequence
MEVNGDTDVLFLPFAAAISHVGERYNNEDNFLILKLPDSYLLAVADGVGGHSSGEVASRI
AIEVLKETLLQEYEPGAPGYLTLITLRKAYELAHSRILENATGERKGMGTTLVSALVSPG
RVLIANTGDSRAYLIRNGKIITRTKDHSLVQELVDKGEITPDEARRHPMRNIITRALGAK
FEVDFYEWKLRHGDVLLLSSDGLHDYVAEGRIVGIASQGRSAEEIAKKLIEEALPVTRDN
VTVMVWRW
Download sequence
Identical sequences I3ZW36
gi|390961880|ref|YP_006425714.1| WP_014789551.1.33015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]