SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|521460530|ref|YP_008147201.1| from Sorangium cellulosum So0157-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|521460530|ref|YP_008147201.1|
Domain Number 1 Region: 404-678
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.59e-56
Family WD40-repeat 0.00074
Further Details:      
 
Domain Number 2 Region: 11-321
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.6e-45
Family Protein kinases, catalytic subunit 0.0000672
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|521460530|ref|YP_008147201.1|
Sequence length 681
Comment hypothetical protein SCE1572_03695 [Sorangium cellulosum So0157-2]
Sequence
MQELADFFGWVGTTIEGRYRVDEVVGEGGFGVVYRGYHLGFDEAVAIKCLKLPTTMSTPQ
RETFLAAFIEEGRLLHRLSRASAGIVQALDVGASLSPTGVWTPYLVLEWLRGVPLNRDFE
ERRASGEPRRPLADAIALLAPAAMALDIAHRQGVAHRDVKPANLFLAEISDRPTLKVLDF
GIAKVMSDFASTTQVMAETGNSVQAFTPQYGAPEQFNRSFGATGPWTDVFALALVLIEAA
SGRFALKGDDFVQLYVTATDRAHRPSLGYLGVPAPAAVEAVVQRALAVEPRERYRTAGEF
WDALDRARKPTVPPSLYHNTALADTSPASPDQGIAPQAPIEAEPKTKRGAPDAHREDVAR
HPIRRPAQRIDRPPRVATPVADEPEIRLVHDAVRDTTSLSVPGLTPRTLAFDERGSLFVG
FGMGVVLCLDLATRSPRWWQRVSSSVVCITVGAGWLAIGCGSGDIHLLNVSRRTIEKTIR
GHSAAVRSMDMHRQAQTLVAGSDDKNVTLWSVPRGELLHHGMHPGRIRSVVFNGLGGLAS
AEDDETVRVWDAKLRPKRVLQIDGASARTLSSSPGGNYLAAGCDDGAIRLWDTAGWELKY
RLIAHRMRVASMAFDPRGEIVVSGSSDGTVLVWEAASGRTLRVLGDYADAVECVAVSPDG
RHVAASCTDGTVRVYRWSSAP
Download sequence
Identical sequences S4XML8
WP_020732738.1.94496 gi|521460530|ref|YP_008147201.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]