SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|521460827|ref|YP_008147530.1| from Sorangium cellulosum So0157-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|521460827|ref|YP_008147530.1|
Domain Number 1 Region: 946-1275
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.03e-89
Family WD40-repeat 0.0000827
Further Details:      
 
Domain Number 2 Region: 1159-1484
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.24e-89
Family WD40-repeat 0.0000414
Further Details:      
 
Domain Number 3 Region: 64-350
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-64
Family Protein kinases, catalytic subunit 0.0000363
Further Details:      
 
Domain Number 4 Region: 1451-1566
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 4.71e-30
Family DPP6 N-terminal domain-like 0.025
Further Details:      
 
Domain Number 5 Region: 384-608
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000027
Family ABC transporter ATPase domain-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|521460827|ref|YP_008147530.1|
Sequence length 1624
Comment hypothetical protein SCE1572_05370 [Sorangium cellulosum So0157-2]
Sequence
MVIEPHEQSTPESSSEDLARTVMLAVTPASSGDQAHGATPLQAGTRDGGAEPSAGHMPVG
VGGTLKHYEIIRTLGRGGMGVAFLARDTKLGRLVAIKVLLEYTGDTVERFLAEARATARC
RHENIVVIHEVDEIHGYPYLVLEYVKGRTLRAWMAQREHPSAPGSPGAATPPCPRAPAVA
IELLIPVVRALVCAHELGIVHRDLKPENILLDDAGAIKVLDFGIAKRMEAEGAATLSGVR
AAPRGGASLSRSSAAIGTPRYMAPEQLLGTGVDPRADLWAVGLLLYELLAGEHPLEPFSL
ARLSDIVNFAAPMPSLAARRPDVGALGELVDRCLKKRSAERVGSARELLAELEALLPGRR
ALPLGEDESPFAGLSAFQEADAAWFFGRDREISAMTARLRHQPLLVVAGPSGAGKSSFVR
AGVIPALKRSGDLWEAFILRPGRAPLAALADVLVQVAETETKGGALTGAPERLDHDGIVA
ALRAQPGTLGARLRARCRREGQRRRVLLFVDQFEELYTLGAAPEERAAFVACLEGAADDA
SSPLRVLLAVRSDFLERMADDQAFLRDATRGLSFLPPMGREGLRDALTRPLETAGHRFET
AEMVEHMLGSLERTRSPLPLLQFTATKLWEARDRERRLLTRDSYDQLGGVAGALSAHADA
VLSALSSREQRLARAVLLRLVTPERTRAVVSLDELRDLAQGSEGDAVAQVVQHLAGARLL
LIETGGEQAVGERDGTTVELVHESLIERWPKLRQWLAESEQDAEFLARLRAAAQQWEASG
HAEGLLWRDSAAEGARGWYERRRAAQGDGGRSGLGFREERYLLAVVALCERARRLRRRLA
TGMIATLTAIAVMVSFLAVRASQQAARASQQAARANQQAMRADQEAARAHVEAREARNAT
RMATAREMQDDPTTVLAILREVEPPDVPRAWSVLALSALHGGVARAVLSHPDFVLRVSYS
PDGKHLLTACADRTVRVWNADGTGGRVVLRNPEATVDSAAFSPDGQRIVTASYDRIARVW
NADGAGEPVVLRGHGDRVHSAVFSPDGKRIVTASEDGTARVWNADGTGEPIVLRGHAEGI
HAATFSPDGQRIVTASYDRTARVWDADGTGELLVLRGHENGLNAAAFSPDGKRIVTASED
GTARVWNADGVGEPLVLRGHGARVCSAEFSPDGKRIVTASYDRTARVWNADGTGEPLVLR
GHEEDIHVAAFSPDGKSIATASHDKTARVWNADGTNELKVFRGHEAEVNMATFSPDGRRI
VSASADRTVRVWNADGTGRPLILRGHEADVFSAEFSPDGRRVATASTDRTARVWSADGTG
EPIVLRGHEARVYSAAFSPDGKRVATASDDRTVRVWNADGAGEPIVLRGHGLAAGWASFS
PDGQRLVTGSLDGTARVWNADGTGEPIVLRGHEDRIWSAEFSPDGKRIVTASADRTARVW
NADGTGEPIVLRGHEDRIWSAEFSPDGKRIVTASADRTARVWNADGAGGPIVLRGHEFQI
FWAEFSPDGKRVATASADNSVRLWDADGTGELLVLRGSDSGVNSAAFSPDGRRIVTASDD
KVVRIWADIEPLLGVDDPKLWAATSYCMPIERSMDLLRVPEAMARANRETCLRRVEQARA
AARE
Download sequence
Identical sequences S4XTS6
gi|521460827|ref|YP_008147530.1| WP_020733067.1.94496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]