SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|521462769|ref|YP_008149668.1| from Sorangium cellulosum So0157-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|521462769|ref|YP_008149668.1|
Domain Number 1 Region: 144-186
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000262
Family VWC domain 0.047
Further Details:      
 
Domain Number 2 Region: 104-146
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000764
Family VWC domain 0.041
Further Details:      
 
Domain Number 3 Region: 63-102
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000429
Family Fibronectin type I module 0.077
Further Details:      
 
Domain Number 4 Region: 21-64
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000575
Family VWC domain 0.041
Further Details:      
 
Weak hits

Sequence:  gi|521462769|ref|YP_008149668.1|
Domain Number - Region: 204-225
Classification Level Classification E-value
Superfamily PMP inhibitors 0.000576
Family PMP inhibitors 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|521462769|ref|YP_008149668.1|
Sequence length 301
Comment hypothetical protein SCE1572_16240 [Sorangium cellulosum So0157-2]
Sequence
MLAFALALSCTLAGCRFIGMATCEHNGVDYSPGDKFPDGDGCNGCTCNDDGSVYCSAMSC
DESCTWKGDAFPSGASFPAGDGCNTCECLKDGTVSCTLAQCEGACTYDGLPYAPGDSFAA
LDGCNTCTCDPAGSGDVGCTEISCDGCERDGRTYAVGALVPSGDSCNSCTCSADGSIVCT
DAACPEGCTYGGVEYAPGDSFSSLDDCNTCTCARGGGVSCTERYCGCDPSREWWRQYVST
SPEECAAIDFACTGSLTYVSNECGCGCEQDPSCPPSFDCKAPEACDLDEIQQRCPYSTID
R
Download sequence
Identical sequences A0A150PR41 S4XVI2
gi|521462769|ref|YP_008149668.1| WP_020735196.1.94496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]