SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|521464352|ref|YP_008151440.1| from Sorangium cellulosum So0157-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|521464352|ref|YP_008151440.1|
Domain Number 1 Region: 147-181
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000051
Family Somatomedin B domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|521464352|ref|YP_008151440.1|
Sequence length 182
Comment hypothetical protein SCE1572_25210 [Sorangium cellulosum So0157-2]
Sequence
MLTNVAVVLSSCVACALLGAAGCYAPAVDDTELAEGEAEAGDPSEDVGLSEDVGVAQEAL
TACDPVLPHGNSAFDSQFTTTIGCACHPWYTKSSYNVWHAGHGDCWPLGWASTDPNDCRV
KVQVKNSGGFFNGECRAHIEDKLDPAASCVNRCGGQAPAGCYCDSLCSRIGDCCPDKAST
CG
Download sequence
Identical sequences A0A150Q801 S4Y3Q8
gi|521464352|ref|YP_008151440.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]