SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|521465241|ref|YP_008152433.1| from Sorangium cellulosum So0157-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|521465241|ref|YP_008152433.1|
Domain Number 1 Region: 1649-1977
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.39e-96
Family WD40-repeat 0.000011
Further Details:      
 
Domain Number 2 Region: 1439-1766
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.93e-95
Family WD40-repeat 0.000043
Further Details:      
 
Domain Number 3 Region: 1231-1515
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.23e-83
Family WD40-repeat 0.0000284
Further Details:      
 
Domain Number 4 Region: 369-662
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.34e-67
Family Protein kinases, catalytic subunit 0.0000218
Further Details:      
 
Domain Number 5 Region: 3-220
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.78e-42
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 6 Region: 690-761,794-879
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000818
Family Tandem AAA-ATPase domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|521465241|ref|YP_008152433.1|
Sequence length 2035
Comment hypothetical protein SCE1572_30225 [Sorangium cellulosum So0157-2]
Sequence
MMFQGRYELLSVLRESSLGTVYQGRQVETGQPIALRLMRLDRGGDPADPEDLARSLQEMR
RCARLHHPNITRPIDWGQADEGHVFTVSELVPGQSLAELLSQQGALDPQEARHLMRQVLD
ALACAHRQGIAHGALRPTHVMLVPSAAARRDARVLDFGVAAVAASLRSGRGGGPASGTEP
LGSLAYAAPEQIWGPAPTARSDLYAWALMFLECLTGRRAHRASPPDGPPDGPPDGDDVQH
QDRGPVRIPPALLGHPVGAIVRRATSEEADERLVTAEGLLRELDACEPGGLRRAALVDLG
APLGAETAESPGSRPPARPPPQPAAGALPEAVDTPEMSGAALPAEEAPTTPADALATPGD
ALAAYAPPNVGDTIKHYEIIRKLGQGGMGVVFLARDTRLGRLVAIKLLREHSRQGIGRFL
AEARATARCRHENIVVIHEVDEIHGHPYLVLEYVKGRTLREWMSQREHPSASGSPIAHTP
PGPLSPSLAVELMIPVVRALACAHELGLVHRDLKPENIVLEDTGSIKVLDFGIAKQIEAE
RISVFTGVRMVLAGGARPSAQSTILGTPRYMSPEQLRGADIDARSDLWAVGIILHELVTG
AHPLDPFSAARLVEIVNLELPMPAAGERRPDVGPLGALIDRCLKKRAAERIGSAKELLAE
LEDLLPGRTSLALSEDESPFAGLAAFQEADAPRFFGREREVAALLTRLRNQQLVAVAGAS
GAGKSSFVRAGVIPALKRLGDRWEAFILRPGHRPLSALVDVLAQVAEAEPAGATGSPELP
NHDELVATLRAQPGSLGARLRARCRRVGKRHRILLFVDQFEELYTLGAAAEARAAFVACL
AGAADDASSPLRVLLAIRSDFLDRIADDHHFMTEVTRGLSFLPSMGRDGLREALTRPTDA
AGHRFETPAMVEHMLSTLESTRSPLPLLQFTAAKLWEARDRERRILTRESYERLGGVAGA
LSAHADAVLSALPPHEQRLARAVLLRLVTPERTRAVVRLEELRELARDGQGDADQAIAQV
VQHLAAARLLLIETGGEREGTTVELVHESLIERWAKLGQWLAESEQDAEFLARLRAAAEP
WDASGQAEGLLWRDRAANDARAWYERRRAEHGAEWRAGLGRREERYLLAVVAHCERARRL
RRRLTTGVIAALTAFAVAVSYLAVRADQQAARADREALRARNATRVAAARELHADPTSVL
AILREVEPHDEPRGWAVLARWALYSGLSRAVLVHPDGVLDADYSPDGRRIVTASADRAAR
VWSADGTGEPIVLRGHTAQVDSAAFSPDGRRVVTGAQDRTARVWNADGAGEPIVLRGHTA
QVDSAAFSPDGRRVVTGAQDRTARVWNADGAGEPIVLRGHTAQVDSAAFSPDGRRVVTGA
QDRTARVWNADGAGEPIVLRGHDDRVYAAAFSPDAARIVTASADRTARVWRADGAGEPIV
LRGHTDQVYSAAFSSDGERIVTGSQDRTARVWRADGAGEPIVLRGHDDRVYAAAFSPDGE
RIVTASWDRTVRVWNADGTGEPIVLRGHTDRIYGVAFSPDGRRVATASQDETARVWSADG
TGEPIVLRGHADRVYAAAFSPDAARIVTASADRTARVWRADGAGEPIVLRGHADRVYAAA
FSPDGRRVATASQDETARVWNADGTGDPFVLRGHDDQVYSVAFSPDGHHLVTASHDRTAR
VWNADDTGEPLVLRGHTDRVYGAAFSPDGRRVASASLDRTVRVWNADGTGEPIVLRGHDD
EVNSVAFSPDGQHIVSGSADKTVRVWRADGDGEPIVLRGHTDQVYAAVFSPDGQRIASGS
WDRTVRVWRADGAGEPLVLRGHTDRVYAAAFSPDGQRIVSGSSDNTARVWRADGAGEPTV
LLGHDDGINAVAFSPDGRRVATASWDRTARVWRADGAGEPHVLRGHEHWVLGVAFSPDGT
RIATGSQDETVRVWHGGGAGEPLVLRADSPINAVAFSPDGQRIVAAADDRVVRVWTDLEE
LRSVDDPKLWAATTYCMPVDRRMELLRVPEAAARASREACVRHVEAARAAAGRPW
Download sequence
Identical sequences S4XYT6
gi|521465241|ref|YP_008152433.1| WP_020737953.1.94496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]