SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|521465818|ref|YP_008153071.1| from Sorangium cellulosum So0157-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|521465818|ref|YP_008153071.1|
Domain Number 1 Region: 1332-1659
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.27e-92
Family WD40-repeat 0.0000193
Further Details:      
 
Domain Number 2 Region: 947-1238
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.11e-84
Family WD40-repeat 0.0000323
Further Details:      
 
Domain Number 3 Region: 80-252,279-375
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-64
Family Protein kinases, catalytic subunit 0.0000582
Further Details:      
 
Domain Number 4 Region: 1205-1323
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.01e-25
Family WD40-repeat 0.00074
Further Details:      
 
Domain Number 5 Region: 406-628
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000924
Family Nucleotide and nucleoside kinases 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|521465818|ref|YP_008153071.1|
Sequence length 1718
Comment hypothetical protein SCE1572_33440 [Sorangium cellulosum So0157-2]
Sequence
MMTRAREHDAPERSPEDPDGGAAREFVLARTAPADAEPRPSTAERAPDSIPVPRPPPASR
AAPGRLRAPPSGGPLDVGGVVKHYELIRKLGQGGMGTVFLARDTKLGRLVAIKFLVERSG
KMAERFLAEARATARCKHESIVIIHEVDEHGGYPYMVLEYVEGQTLREWMTERARAAVPE
PLADRGAPTGLVPPGLAVELMIPVVRALICAHQLGIVHRDLKPENVLLDDAGPVKVVDFG
IAKQIDTGELPTVVEGEPALSSAGGLGDASTARLDRADVVAGTPAYMSPEQWLARSIDHR
ADIWAVGIMLHELVTGEHPLEPFSLARVPDVVDLDLPMPGAGERRAGLGALGQVIDRCLQ
KRATERIGSAKELLAELEALLPDRKALDLRDDESPFAGLAPFQEADAPRFFGRDRDIAAA
ARGLCSQRLLAVAGPSGAGKSSFVRAGVIPALKRSGDRWETFVLRPGRRPLSALCEALAQ
AAGATPRDPAAVQTDLPDREALVATVRGEPGYLGARLRARCSRQGPRHRILLFVDQFEEL
YTLGASPEERRAFVACLEGVADDASSPLRVILAIRSDYLDRVADERHFMNEVTRGLSFLS
PMRREGLREALMRPVEAAGHRFEEADMVEHMLGTLASTPSPLPLLQFTATKLWEARDSER
RLLTWSSYHRLGGVAGALSAHADAVLSGLSSREQRLARSVLLRLVTPERTRAVVGMEELF
ELAPEADGDGRGAIEQVIHQLSGARLLHIETSGEREGPTVELVHESLIERWPKLGQWLDE
SGQDAQLLARLRAASQQWESSGRPDGLLWRDRAAQDAWRWYERCRAEQGADLRLGLGRRE
ERYLAAVVALLERTRRLRRTFALTVIAALGAIAIVVSYLAIRAEEQATRAEGAATRAHVE
ALQARNATRMATARELEADPTLVLAILREVEPPDVPRGWSVLARWALNRWVARAVLTHPE
GVTRVGCSPDGKRIVTASQDRLVRIWDADGTREPLLLRGHDDWVDSAAFSPDGTRIVTAA
QDTTARVWRADGAGEPLVLRGHEGRVFSAAFSPDGTRIVTASQDTTARVWRADGAGEPLV
LQGHEGRVYSAAFSPDGTRIVTASQDRTARVWRADGAGEPLVLRGHGDRVSSAAFSPDGT
RIVTASQDRTARVWDLRHTKEAVVLRGHEHGLSSAAFSPDGWRVITTSFDRSARIWSVDG
TGEPLVLRGHGDAVMSSVFGPDGTYVVTASQDRTARVWAIDHRDEPLVLRGHEHWVSSAV
FSPDGRRIVTASQDRTARVWSADGTGEPLVLRGHEDRVSRAAFSPDGRRIVTASQDRTAR
VWSADGTGEPLVLRGHEDRVSRAAFSPDGRRIVTASQDRTARVWSADGTGEPLVLRGHED
RVSRAAFSPDGRRIVTASQDRTARVWSADGTGEPLVLRGHEDRVSRAAFSPDGRRIVTAS
QDRTARVWSADGTGEPLVLRGHEDRVSSAAFSPDGRRIVTASQDRTARVWNADGTGEPLV
LRGHEHWVFSAAFSPDGRRIVTASQDRTARVWRAADASELLVLRGHDDGVLGASFSPDGA
RIVTASWDATVRVWNAAGTAEPLTLLGHEHWVHAAVFSPDGERIVSASQDTTIRVWSADG
SGEPLVLRGSDSPVNDVAFSPDGKRIVSASDDSAVQVWSDLAPLRGTDDPALWIATTYCM
PVDRRIELFRVTEATARASWEACRRRVEEARAAERRAR
Download sequence
Identical sequences S4Y2G8
gi|521465818|ref|YP_008153071.1| WP_020738590.1.94496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]