SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|521467186|ref|YP_008154564.1| from Sorangium cellulosum So0157-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|521467186|ref|YP_008154564.1|
Domain Number 1 Region: 548-885
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.94e-70
Family WD40-repeat 0.00016
Further Details:      
 
Domain Number 2 Region: 844-1183
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.68e-57
Family WD40-repeat 0.00047
Further Details:      
 
Domain Number 3 Region: 55-247
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000399
Family G proteins 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|521467186|ref|YP_008154564.1|
Sequence length 1238
Comment hypothetical protein SCE1572_41020 [Sorangium cellulosum So0157-2]
Sequence
MSGSTPPEGAPADEAPADEAPSSLAVPSIGRPSGADAERTGIFTAPNPFPGPQPYRAADR
ERFHGREELSYRLEASVLANRCVTVYGPSGAGKSSLMQASVIPSLVDTQRIRVVRIDAWP
ENKEPTEWLADAVYTALSFGERPADLPAEEALLSAAQRAGRKSPRIVLLYLDQIEQLLYP
SRSTTEVEAFFAALNRLVDTPLRGLRAVLLLREDYLGRFRDRLREHRRLLSHGFRVGPLT
VAELSEAVCKAAAGGQPPQTWELEPMRTLLLQVRMPGQAESDEAEAQAAYAQIVCRALFQ
QRAQGGDAAKQEAVEAEPILRRYLEATLDDLGALSAAARRLLEDHLVTADGSRTLRTEKE
LLRLFPAEELGPILKALEGAAILHAEEHQGSRYFEIGHDWLARRVSEARQQRELEEAQRR
REEEQVRELARERGEAERRLRKARAQRRFFATVAVVAVVVAAGAVVLVLYAYGQRERAQA
AMSEAQAAEANAKNKEIEASDARLLAGFRELKNGGQMAWGIKLLPEVKRPETARGWVALA
SDALGQNSLFVTLRGHDQPLRAAVWSHDGQWVLSASDDTTARLWNAGGTGDPVVFSGHQG
AISAVAFSPDDKRVLTASEDGTARLWGAGGNLIAVLLDAGSGPVRRAAWSPDGGRVVTAS
ADHVARVHSVDGGGVVELKGHTGPLNAAVFFDDGTRVLTASDDGTARVWAADGAGKPVIL
RGSEAGVLFAVPSPDGTRVLTGCSDGTARIFDASGKGKPVVLEGHQGNVLFAAWSRDGAR
VATASADKTARIWGADGTGEPVVLAGHGRAVTFVAFRPDGRYVATASLDHTVRLWPSEGG
KDLVLAGHDAPVLSAAWSPDGTRVLTAAAPQVGVPSRDSTVRIWRPTMLESLPRERSAFY
HSAFVGPGAELVASAYDDRTVRVWRADGTGESVVLAQQDAWIANASLSPDGARVAVAGFD
GVTRIVRVDAKGDPVSILGHTAAVRAAAWSPGGTLLVTVSDDRTARVVSVNGAGSARVLS
GHTDGLTSAAWSPDAQRIVTTSMDHTARVWLASAAQELVAFKGHGGAVYSAAWSPDGAWI
ATGSEDGTVQVWDARSGAVAASLDRGVAVLQAIWSPGGDRIAVSLRQGGVLLWSREAWER
PGMSEPVQLDTQAAILAMAFLDGGKRLFTVAADNTTRTFTIDADELRRGLLSSNVDCLPA
SLRVLHLGEAPDRASERYAACEREHSRTPFFGSGQEGQ
Download sequence
Identical sequences S4Y4I9
gi|521467186|ref|YP_008154564.1| WP_020740071.1.94496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]