SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|521467824|ref|YP_008155279.1| from Sorangium cellulosum So0157-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|521467824|ref|YP_008155279.1|
Domain Number 1 Region: 61-116
Classification Level Classification E-value
Superfamily BPTI-like 9.65e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0039
Further Details:      
 
Weak hits

Sequence:  gi|521467824|ref|YP_008155279.1|
Domain Number - Region: 134-204
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0348
Family WD40-repeat 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|521467824|ref|YP_008155279.1|
Sequence length 280
Comment hypothetical protein SCE1572_44645 [Sorangium cellulosum So0157-2]
Sequence
MRRRFSFGLGLLTSLLLAAGCSGADAGGDGGAGGAGGGGPVTGSGGGGGPVTSSGAGGEL
PNRCSLPQDPGPCDGAIQRYWHDPSSGVCVPFIYGGGGGGENRFESLQACQEACQGNVPD
MAACAAPGDCVLASPRCCAACNPNDAHAFVAVHRDSTTDFWNTLGCGDVACAPCPEVSEA
ESTGQYFAAACEAGRCVVLDVRESPLTECAQDADCALRDGVGCCEECSGKGIVALNQSAD
IESIVCPEGFGACPPCAPVYPEGMTAVCLEGRCQPKLSSP
Download sequence
Identical sequences S4Y9Q6
gi|521467824|ref|YP_008155279.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]