SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|521467856|ref|YP_008155314.1| from Sorangium cellulosum So0157-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|521467856|ref|YP_008155314.1|
Domain Number 1 Region: 677-951
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.01e-61
Family WD40-repeat 0.0003
Further Details:      
 
Domain Number 2 Region: 875-1122
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 1.02e-41
Family DPP6 N-terminal domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 541-742
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 1.7e-35
Family Tricorn protease domain 2 0.027
Further Details:      
 
Domain Number 4 Region: 47-265
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000131
Family Extended AAA-ATPase domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|521467856|ref|YP_008155314.1|
Sequence length 1176
Comment hypothetical protein SCE1572_44820 [Sorangium cellulosum So0157-2]
Sequence
MTFSAPPDLDQAKASAGDHRRRFQAGGTVGDGAIYIERSADTELFEALLGGELCYVLSTR
QIGKSSLRLRVSMRLRAEQIECASVDLGALGTDTATPVGWYLGIASEIAEQLGLEPPDEF
WDAHWHLGPVHCWLRWLEDVVLVEISSGIVLFIDEVDATLSLPFSRDDFFAAIRAFVNRR
AERPANARLTFCLLGVAAPSELVSDPTRTPFNIGRAIRLDDFTRAEVRGFRAGLEGLVAD
PDAALDAIFAWTSGHPYMTQRLCADLVGERRGLSVDEAVERRFLGKGRAEDPNLRYAERC
LEPHGPHRAHAPKLLRLYTRLLDGHPVSVDSGDPIQLLLRLSGLCAERATAAGAPCLDVR
NRIFRRAFDRAWAGSREVERAVTDPLLRWLSNGRKDDFLVGGAALAELTSWCDGRGDLSA
EERAFLTACARAEGQKRSMRRLLTVLAVAVTLLGGMILALLWQMGKEEQALARAQQDARE
KDARRLAAQSAKELSDGLLPRARLLAVEAGLAARASGRPAAATVVQALGDAVRGPAVGQE
VLTGHGGAVHDATFSPDGRFVATASADGAARLFRLGARDAPVLLRAHDPGGVVAVAFNHD
GSRLATASTDGTVRLWRPDGREDGALPTRDAAPSSVAFSPDGSRVVAGTTSGAIYVWRPG
MGDEPPLVVPLGERLIRRAVFNHDGTWILATAISGTVYVVRADGHGAAEALKGLGQGVEG
ASYSPVDARIALAAGDGTARILEPGRREPVVLRGHQGSVRSAAFSADGTSVVTASADGTA
RIFRCDGKGTSTVLVGHEGAVNSAAFSRDGRSVVTASEDGTARVWRLEAPGEPLLLHGHT
GPLTSIAVSHDGSKIATAGTDKTVRIFRADGSGEPVVLRGHEEHLLSVDFSPDGSRLVTG
SADRTARLWRADGKGEPVVLGTHDDRVVGVAFSPDGTRIVTTSWNGILRVFEDGVPGEPV
VLRDERAGLLKAAFSPDGKSIVATSGPNVKVWPADGRGAPRVLASGYEDRAIAALAVSPD
GSHIAIAALDDAVRLLRADGQGQPLVLSGLGTSVRTVSFSSDSARVVAVSSDGVARVLPV
DGQGEPITLRAEGVTLTDAVFSPDATRVVTAANDGAARVFTIAAEPLLMRACAYAGRNFT
REEWALLMPDIAYRVTCPEWPGAPEPDAGAAPRRDR
Download sequence
Identical sequences S4Y6G3
WP_020740813.1.94496 gi|521467856|ref|YP_008155314.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]