SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|521460272|ref|YP_008146906.1| from Sorangium cellulosum So0157-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|521460272|ref|YP_008146906.1|
Domain Number 1 Region: 3537-3729
Classification Level Classification E-value
Superfamily TPR-like 7.59e-17
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 
Domain Number 2 Region: 86-111,152-504
Classification Level Classification E-value
Superfamily TPR-like 1.21e-16
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 
Domain Number 3 Region: 3255-3305,3334-3370,3400-3452
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000152
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 
Domain Number 4 Region: 967-1011,1207-1243,1271-1317
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000142
Family Tetratricopeptide repeat (TPR) 0.04
Further Details:      
 
Domain Number 5 Region: 2175-2365
Classification Level Classification E-value
Superfamily TPR-like 0.000000000136
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 
Domain Number 6 Region: 1509-1558,1587-1623,1723-1774
Classification Level Classification E-value
Superfamily TPR-like 0.00000000813
Family Tetratricopeptide repeat (TPR) 0.045
Further Details:      
 
Domain Number 7 Region: 893-933,970-1098
Classification Level Classification E-value
Superfamily TPR-like 0.000000172
Family Tetratricopeptide repeat (TPR) 0.056
Further Details:      
 
Domain Number 8 Region: 1348-1370,1438-1530
Classification Level Classification E-value
Superfamily TPR-like 0.000000417
Family HAT/Suf repeat 0.076
Further Details:      
 
Domain Number 9 Region: 522-710
Classification Level Classification E-value
Superfamily TPR-like 0.000000625
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 
Domain Number 10 Region: 1110-1262
Classification Level Classification E-value
Superfamily TPR-like 0.00000177
Family Tetratricopeptide repeat (TPR) 0.048
Further Details:      
 
Domain Number 11 Region: 2990-3139
Classification Level Classification E-value
Superfamily TPR-like 0.00000711
Family Tetratricopeptide repeat (TPR) 0.098
Further Details:      
 
Domain Number 12 Region: 2571-2976
Classification Level Classification E-value
Superfamily TPR-like 0.0000133
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 
Domain Number 13 Region: 2503-2603
Classification Level Classification E-value
Superfamily TPR-like 0.0000273
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 
Domain Number 14 Region: 1893-2059
Classification Level Classification E-value
Superfamily TPR-like 0.0000778
Family Tetratricopeptide repeat (TPR) 0.0042
Further Details:      
 
Weak hits

Sequence:  gi|521460272|ref|YP_008146906.1|
Domain Number - Region: 660-843
Classification Level Classification E-value
Superfamily HCP-like 0.000146
Family HCP-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|521460272|ref|YP_008146906.1|
Sequence length 3739
Comment hypothetical protein SCE1572_02165 [Sorangium cellulosum So0157-2]
Sequence
MALGRLQDEPENEAAWNELAEAVTAPNNGAGAGDVERLLGAARARHEQRREWQAVARLLE
LEIALAAGSPVEGAMQAELARVYHEELIDVDRATAAYKRLLELRPDDDAAAEALETDASK
RERWRDLVDRYVAEAEAATDGAFKSALTTSAADIAYRYGRAELGEKVTELIDLALKLDPK
NRRAANLAEIAFAAAGDWEAVVRVQSLVKAEAQAKEDRVAAGLRSARTIKTHLNDAARAV
AAYEEVLDLSPGQPEALSFLAEAYSAAGDWDRLVALYEDQLRSGGVKPGEELGMLVQIAM
VHWRMRGQPQAAEPYFDRVRRADAAHAGMLNFYREVLEQRGDKPRLTTILTDAQRALPDG
PEKRAIATELARLAESQENAAKAIEQYKSVLRTDPENRQARDALKRLYLQTEGYNALVEL
YRQDLERTPADDVAGRVAVLREIAGIYRDRAKNDAALVTVLTQIVQLDDKDVDAVRELTR
IYEALGRWRDLLSYQQRLAELTESRAEKAGLYRAVARRWFDQFSNVQNAIAAYEALLTVE
PIDEEAQQKLRELYLKRRAWPQLYSLYERKLESAEGAAKIELLGEMAKLAAERLDRGADA
IALQKRILELDPSAPGVLDALEKQAEREKDFATVAEVLERRVDLAADDAARLVSLQKLGA
VYAERLKDPAQAARTWRRVLTLSPGHARALRVLRDAYFAAGDWDGLEELYASQNDWEGLV
DFLSGAADKATDPATKLDISFRAARIFEEQLKAPERAARSYERVLSVSPRDARAAAALVP
IYEEEEKWARLPALYEILLDATDDAEAQVGMLRKLAAVTGGPLSDKASALGYARRAYELK
PDEEGLDLLEAWSRAAGSWGPFVEAVEGRLRTATDLATDVQRTLRLKLAEVYAREMGKLD
EAVTVYRGLVEDDPSDDATVRALDALLRANERQADLRWLFELRASQVGGEDRAEILEEWA
TLEEEVFGDPAKAIELLRKVIALAPGRINALRVLSRLLNAAGEYEAAAEIVATHRDVSEG
DERARREIELATLYLDRLDRPADAFEAAVRALELTAHDPDAIAVLSRLVERPETRVRAAR
VLAVEYAETGNHRREAMALRVILEAERDPERRRELYLTLANVEETKLHAAGTAFDALLRA
LHEFSDDIELWDRAAELSRRAGRPTDLAEAYRVHLVAGRTEGDKVLGSSVEVELCERAAS
LHDEQLGDPEGAKPYLERVLSLDPNSHRAFERLKQILTAAERWGELEELYDRAAKGTTDQ
SERIELLNEVALIAEEIIGDAAKAIGYYERILELDPFYTAALDSLEKLYEREGRFRDLAA
LLEQRLKTATESESVEMKLSLGSIYLDRLHEPEGSLGHLEDVLRIRQNDPKARELVERLL
DIGALRLRAARVLEAVYEARDEIRQLVRVLEIRRQGAETESEQRELLRRVSVLQDERLKD
DAGAFASLSELLPLEPEDLAARERLIEIGRRLGEHEQVAEVLTAAADACGTASIRGEILM
EVARICEDLLGDADRAEKVYRRVLSIDPTDPSLVIPAAQALGRIYAAKEEHQALAGVLAI
EVRLEEDADTRRSLYERIGTLYETVLDDPTKAIEAWQARLGDDSADAAALAALERLYERT
SQWRELVSVLRAREQSTTEPEERRRAMTKAAETLAQRLADVPEAINAWRAVLDEFGPERS
TLAALEALYELDERWVDLADTLETDLSLAVETPARLDLLARLGDVRRLHQGDAAGALEAY
RQALSLDPSNARCRAALEAMLERDDARRDAAETLEPLYEADGDAERLLRVLEIKVETSDL
PSERLATLQKALRTAEGPLGDTSRAFGYALRGVREAAGEPDVTTWIETVERLGEATGRWA
EVCELFQRIAPDILDGDVQQNVRLRVGELARHKLDDRELAVEQYKKALEAHGDDRRAMIA
LEELYGEANDAGRLLAILKLRVENAESDEEKTGLLFRIAELERGPLGDQAGAIATYETIL
DIALHPDAIAALDSLYREAGRFQDLIRLYERQLDVRAGDLAELHVKIALVAHRHTEDLER
AFDELSEALLIDPAHEGAVSLLETILAGSAEAEHRARAGEMLEPVYLRRADWNRVRVALE
ARLAASQDPVERRDLLQRLATLHEEQLEDYRAALETVAKLLHEDLTDEGVWAELERLAKV
ASAERRLAEIYAAELGELTSDDASSAKLSRRTGELYAELGDVADALKWYRRAHEFEPDSR
ELFDAIDGLLIKEGRHAERIQLYRAALDYRKDEDRLDALHTIARLERTELREPALAIETY
RAALDVDEGDARALDALTELYRELDRPRDLADLYLRRAEAAPDGHRAAPYRLALAELLRT
RLEDTAGAIDQLEAIVGEVPTHAEAIRALEALIQDPQHKARIVEILRPLYEGADDWRQLI
RLNEERFGLASDARDKVAVLRETAKLWETRGSDELRAFDAIRTAFSLDPDDGETRGELER
LAEQLGAWEELAESLEQGVTITSDELTKRELLSSLAKVYDTRIDDPRRALRAYARLSALD
PSDPEPLEQMDTLAVLLSDWDTLISVLEKKSEMASDEENASICRRIAETKLEMLEDTEGA
IQAYERALELDPESAMTIDALIELHEPRGAASRLVELYGRRVELAGADEEELRYDLNVRA
AERYEKDLSSPRDAITALTAALDAKPGDPAVLSSLERLYRAERMWDELLSNLMLQASAAA
DRDARVKLRTAIGDLYARELESPSDAIEQYRLVLDEDPANDHAIQAVRAIGEGREELRLD
AAQVLEPVLRAAGRHEELAAALELRLRAQTEPSDRAETLRAIAAVQDVQLGRPLEAEQAL
LRALEDAPDDASLHGEIERLAERTDGFGRYCDALAQRAASTFDATIAKDLFLRIGRIAEE
KLKDDRRSAQAYAKAVEHAGDTPELLEALDRLYGRLGDEKALADVLERRVAVTSGDRDQA
DLFYRLAVIQIESFGDKAQGLNTLRQALDHAVDHERASAALEALTEDPALFDEAAEALEG
VYRTRGDNAALARLYEKRIRFAPTGVERIRMRLDLAKVLEVRSNDPRAALETLEKALADD
PSDPDVLGEIERLAPLTGGWASAAAALERAVRAGADLDSDTARDLWMRIAEWQKNKVGDP
KAAEAAYEAALTHDPTSEHILRSIEELQRAPGRERDLIGTLRRIAALDGMEGTAAELRRE
AKELAERALADRELVEAILREMIAADEGDTWALAELTKVREEAGDHKEVFRLLVRQSELY
AEADRIRDARHAAAAVAREKLGDDAAAIELYETLFEADPGDARAATALRELYAKAGKHKE
LLSLLERLTDLAESPEARSALRLESAEICLSRLDAVSEATEHLRAVLDEQPDNEKATVLL
AQLLEKTGRDQELSDLFVTQIERAKDRGDVAAELSYSVRLGEVYETRLNDTARAIETYRA
VLEREPRHPGALLALARLHEQRGEKGEAAQRLEVILEDASGPEAVSTSLRLADLHRSLGD
EGAVRRVLERGLAADASAQDIRKQLLALYEKQQAFTELADLITGDAETAAQPAEKVALYR
KAAGIHLTKRNDPGRAADLLVKATELVPGDRELLLALCDAYSASGRGQKAAEALQQIVES
YGGRRSKDLAAIHHRLAKAYLAEGQRERALAELDTAFKIDPGSIAILRDLGVLALELSES
GDDAAKAAHIDRAQKTFRALLLQKLDEGAPISKGEVFYYLGVISHRQNDDKKAIQMLERA
LDNEKDFAPAKELLAQLKK
Download sequence
Identical sequences S4XS48
gi|521460272|ref|YP_008146906.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]