SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150377820|ref|YP_001314415.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150377820|ref|YP_001314415.1|
Domain Number 1 Region: 7-190
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 7.85e-50
Family Methylesterase CheB, C-terminal domain 0.0004
Further Details:      
 
Domain Number 2 Region: 271-447
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.38e-45
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00039
Further Details:      
 
Domain Number 3 Region: 826-954
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.38e-20
Family Heme-binding PAS domain 0.029
Further Details:      
 
Domain Number 4 Region: 200-273
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0000000000000011
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0055
Further Details:      
 
Domain Number 5 Region: 733-835
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000242
Family Flavin-binding PAS domain 0.074
Further Details:      
 
Domain Number 6 Region: 601-723
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000628
Family FCH domain 0.02
Further Details:      
 
Weak hits

Sequence:  gi|150377820|ref|YP_001314415.1|
Domain Number - Region: 1038-1146
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00011
Family Histidine kinase 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150377820|ref|YP_001314415.1|
Sequence length 1160
Comment putative PAS/PAC sensor protein [Sinorhizobium medicae WSM419]
Sequence
MVQKADPPIVAIGASAGGVQALQTFFDLMPIDTGATFVVIVHLDPHARSELANILAARTR
MPVTQVEDQARLESNHVYVIAPNRRLKIADGTIAALPFEEPHALRAPIDFFFRSLAEEHR
SEFAIILTGAGADGAIGVKAIKEADGIVLVQDPDEAEYASMPRNAIATEVADFVLPIREL
PHRVAELLARRDQLPSHQFRVNDDEMIGRIVAHVRGRTGHDFSQYKRATILRRIGRRAQV
ARRETFADYYNYLRENPEEAQALFSDFLISVTTFFRDPSAFEVLAERVIPHLFDGKEVAD
KIRVWVPGCATGEEAYTIGILLLEEAARRDLSPEIQVFGSDLDEQALRIAREGRYPSTVE
GDLSEERLRRFFQREGDHYRVRRDLRDAVLFASHSLLRDPPFSHLDMISCRNLLIYLDRQ
LQQQVCNTFHYALNAGGFLFLGSSESADCPGLFRPVDREARIYRALAGAGARPMVLPALL
GPHKPEMKSTIIRTPPAGHGSDAAVHRQMLEKIAPPSMLVDESHHAIHLSENAGRFLKPS
GGPVSTAATDLVREEFRFDLRAALHRAFGRNEPTLSMPILADLDGQPHRVYLQVKPVVRG
TERTRHALVLFIEGEAIDKTQEVVLDTLDGRPTIDEAIRRLQEELQLAQNRLRLTSEESD
TATEELRAANEELQSMNEEYRSTAEELETSKEELQSINEELQTVNNELKLKLESISRANS
DLQNLMAATDIATLFLDPSLRIKRFTPRLTEIFNVTSNDEGRPITDFTHRLQYKRLSDDA
RAVLETLKPVEHEVKGRNDGWYLVRMRPYRTIEDKIDGVVVTFVDISERRHAEEAAKESG
QRLEQEMRLVELSRSPIFVWDFDDGVMQWNRGSEELYGYSREEALGRRKEELLKTGVPGS
SFDKLRRTLSQKGRWSGELNHTTKDGRVLTVESQIELVPFGERRLVLESTRDITDRKRWE
RRGQLLLNELSHRVKNTLAVVQSLARQTLRTTRSSEDFVERFEGRLAALASAHKLLVDSE
WSGAELNELARRQLDAYAASDRRRLQIEGEPVTLPPDLATPFGLVLHELATNAAKYGAFS
TGNGQIKLSWKLGNNGRSLGVIWQERGGPPVEPPSEQGFGGVLIEKSLPGSTVHRDFQPD
GVVCTIDIELPEIRPDGGEK
Download sequence
Identical sequences A6ULF2
gi|150377820|ref|YP_001314415.1| gi|150377820|ref|YP_001314415.1|NC_009621 366394.Smed_5776 WP_011970590.1.89664 YP_001314415.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]