SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150395488|ref|YP_001325955.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395488|ref|YP_001325955.1|
Domain Number 1 Region: 111-164
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0000889
Family MgtE N-terminal domain-like 0.01
Further Details:      
 
Weak hits

Sequence:  gi|150395488|ref|YP_001325955.1|
Domain Number - Region: 63-118
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0303
Family FCH domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150395488|ref|YP_001325955.1|
Sequence length 179
Comment hypothetical protein Smed_0261 [Sinorhizobium medicae WSM419]
Sequence
MTGHFEDFIARARRALLGSVAGAFLLSISGAFAQDVTAPPADSAAASEIEKFCTNIADAA
RDQRYVLQRKDLEKLKANVDERIATLETRRAEYEDWLKRRNDFLKQAELGLVDIYKSMKP
DAAAGKLEMVRPEIAAAIVMRLPPRQSSLILSEMSDEKAAMLTNIISSASDPDTSKEPS
Download sequence
Identical sequences A6U640
gi|150395488|ref|YP_001325955.1| WP_011974471.1.29075 WP_011974471.1.31871 WP_011974471.1.61285 WP_011974471.1.7720 WP_011974471.1.89664 YP_001325955.1.44884 366394.Smed_0261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]