SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|529076885|ref|YP_008375888.1| from Halorhabdus tiamatea SARL4B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529076885|ref|YP_008375888.1|
Domain Number 1 Region: 63-305
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.63e-53
Family G proteins 0.001
Further Details:      
 
Domain Number 2 Region: 289-367
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000049
Family G domain-linked domain 0.022
Further Details:      
 
Weak hits

Sequence:  gi|529076885|ref|YP_008375888.1|
Domain Number - Region: 3-43
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0288
Family PspA lactotransferrin-binding region 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|529076885|ref|YP_008375888.1|
Sequence length 370
Comment GTP-binding protein RBG1/RBG2 [Halorhabdus tiamatea SARL4B]
Sequence
MGLQAEIEELEEEIASTPYNKATEEHIGRLKAKLAEKKEEFEKRQSSSGGGDGYAVEKTG
DATVALVGFPSVGKSTLINALTNADSEVGSYDFTTLDVNPGMLQYNGANIQLLDVPGLIE
GAAGGRGDGKAVLSVVRTADLVLFVLSAFEIQQYERLREELYKNKVRLDVEPPRVNVRKK
HKDGIAVNASVDLDLDEQTVKSVLREHEFVNADVTIGEQVDIDRLIDGIMDNREYLPSIV
AVNKVDLIDPSYVDTVKSDLRDIDVDPDDAIFISAEKEKGLESLTERIWDELGLIRIYMD
KPGRGVDYDEPLILTEGDTVGDACEKIGGRFDDRFRFARVSGESAAHDDQQVGRDHELAD
EDVLRLVIDR
Download sequence
Identical sequences F7PGI8
gi|529076885|ref|YP_008375888.1| WP_008524374.1.19926 WP_008524374.1.30395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]