SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|529078092|ref|YP_008377095.1| from Halorhabdus tiamatea SARL4B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529078092|ref|YP_008377095.1|
Domain Number 1 Region: 111-242
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 3.01e-42
Family CTP-dependent riboflavin kinase-like 0.0002
Further Details:      
 
Domain Number 2 Region: 22-106
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000123
Family MarR-like transcriptional regulators 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|529078092|ref|YP_008377095.1|
Sequence length 245
Comment CTP-dependent archaeal riboflavin kinase [Halorhabdus tiamatea SARL4B]
Sequence
MCLSVIPSNPAAMADLPDDSIGYAELATLKLLALAGAVDGDAKITGSGLASKLEASTQTA
SRRLQRLEDADLVAREIVSDGQWVRVTDDGERLLQEEYAEYQRIFEHGIGVTLSGAVQSG
MGEGRHYVSLSGYHRQFVDKLGYEPFPGTFNLSLDDRSARARARMNALDPIVIDGWENGD
RTYGPAYCYPITLESDAATYEKAHVVTPERTHYDDVQLEIIAPDELRDELDVGDGDVVTV
HVHER
Download sequence
Identical sequences S6CTN5
gi|529078092|ref|YP_008377095.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]