SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|529078348|ref|YP_008377351.1| from Halorhabdus tiamatea SARL4B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529078348|ref|YP_008377351.1|
Domain Number 1 Region: 5-220
Classification Level Classification E-value
Superfamily Pseudouridine synthase 3.45e-59
Family Pseudouridine synthase II TruB 0.00000178
Further Details:      
 
Domain Number 2 Region: 222-292
Classification Level Classification E-value
Superfamily PUA domain-like 0.00000118
Family PUA domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|529078348|ref|YP_008377351.1|
Sequence length 295
Comment tRNA pseudouridine 55 synthase [Halorhabdus tiamatea SARL4B]
Sequence
MALRGPPEDRSPAELLSFGVLNLDKPPGPSAHQVAAWVRDLATVDRAAHAGTLDPKVTGC
LPMLLGDATRMAQVFDDSRKEYVAVLELHERLADSAALEAIADEFEGEIYQKPPKKSAVV
RRLRSREIHSLDVLEAEDRRVLLSIRCESGTYIRKLCHDMGLALGTGAHMGDLRRAATDP
FEDSDLVTMHDFVDALAWWREDDDPQALREVVQPAERALVDLPSVTIAPSAAESVAEGAP
VYAPGVIDADDGLDSDAEPLVACYIPNGAAVCLGTLVGDPDSDEGTVVDLERVLV
Download sequence
Identical sequences F7PPK8
gi|529078348|ref|YP_008377351.1| WP_008526480.1.19926 WP_008526480.1.30395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]