SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|529078900|ref|YP_008377903.1| from Halorhabdus tiamatea SARL4B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529078900|ref|YP_008377903.1|
Domain Number 1 Region: 505-687
Classification Level Classification E-value
Superfamily Smc hinge domain 1.7e-48
Family Smc hinge domain 0.00028
Further Details:      
 
Domain Number 2 Region: 1-236,1079-1166
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.55e-43
Family ABC transporter ATPase domain-like 0.00028
Further Details:      
 
Domain Number 3 Region: 712-962
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000144
Family Tropomyosin 0.00083
Further Details:      
 
Domain Number 4 Region: 398-510
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0000288
Family PspA lactotransferrin-binding region 0.0019
Further Details:      
 
Weak hits

Sequence:  gi|529078900|ref|YP_008377903.1|
Domain Number - Region: 972-1034
Classification Level Classification E-value
Superfamily Tropomyosin 0.0628
Family Tropomyosin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|529078900|ref|YP_008377903.1|
Sequence length 1188
Comment chromosome partition protein smc [Halorhabdus tiamatea SARL4B]
Sequence
MYITEVVLDNFKSFGRKTRIPFYEDFTTISGPNGSGKSNIVDAILFALGLARTSGIRAEK
LTDLIYNPGHQDGESPDREREASVEVVLDNADRTLSRSQVVSAAGSENVGDVEEITIKRR
VKETDDNYYSYYYINGRSVNLGDIQDLLAQAGVTPEGYNVVMQGDVTEIINMTAGARREI
IDEIAGVAEFDQKKAQAFEELEVVEDRIEEAELRIEEKETRLEQLEDERETALEYQKLRD
EKEEYEAYQKAAELEDKRDDLDAVREEIADLEETLEQRRRELDEREGKVVRLEDELAELN
AEIERKGEDEQLALKRDIEEIKGEIARLEDAIESAEEKRDEAEARRREAFVEIDRKQETI
DDLAADIRETKVEKSSVKAEIDDLEVDLAAVEEEIEEVGAEYEEVRAELEDQKSSLEEAK
ERRNDLQREQDRLLDEARRRSNQQRDLESTIEDLEDSIPELDAEIDDLQEERRKAEANRE
TITDVIDDLAAEKRDLQAEIEAIDDDLEAARQEYAELEARAAESGDASYGRAVTTVLDGD
LDGVHGTVGQLGGVDPTYATACETAAGGRLANVVVDDDGVGQRCIEYLKNRNAGRATFLP
LTEMDNRSLPSLPSHDGVVDFAYNLVDFEAAYSGVFSYVLGDTLVVEDMATARELMGRYR
LVTLDGELVEKSGAMTGGSSSGSRYSFSDSEGQLQRVAERITELEDERQAYREELGDVEE
RLEDARDRKSEAADQVREIQAEIERREREREETEERIEQRREELDEIEDEREAVSAEMDE
IEADIESVESEIDDLEAEIAGLEAEIEDSRLPELTDEAESLESEIDEREDELDDLDAALN
ELQLEKQYAEDAIEDLHDEIETAQNRKAEQAERIEELNERVAEEESKLADKQDAVAELEA
ELADLKGDREDLRAELQAAQQERDEQKERVNEIESNVDGKRETESRLEWEIDELEDAVGE
YDPEEIPNHHTVQTRIGQLEAEMERLEPVNMLAIEEYDEVEADLADLEDKRGTLVEEAEG
IRDRIDSYEARKKETFMEAFESIDAQFRDIFERLSNGTGRLHLENEADPFEGGLTMKAQP
GDKPIQRLAAMSGGEKSLTALAFIFAIQRHNPAPFYALDEVDAFLDAANADLVGEMVDEL
AGEAQFVVVSHRSAMLERSERAIGVTMQGDNVSSVTGIDLTEEVPADD
Download sequence
Identical sequences F7PNB8
gi|529078900|ref|YP_008377903.1| WP_008527514.1.19926 WP_008527514.1.30395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]