SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|529078940|ref|YP_008377943.1| from Halorhabdus tiamatea SARL4B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529078940|ref|YP_008377943.1|
Domain Number 1 Region: 34-276
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.46e-26
Family Nitrogenase iron protein-like 0.096
Further Details:      
 
Weak hits

Sequence:  gi|529078940|ref|YP_008377943.1|
Domain Number - Region: 300-361
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.00837
Family PspA lactotransferrin-binding region 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|529078940|ref|YP_008377943.1|
Sequence length 593
Comment ATPase-like protein [Halorhabdus tiamatea SARL4B]
Sequence
MNYGCRGHRLEKKRMADSDQRTITVAERSGGHGGTGDVGRPVSLPVVELLTGRGFITGKS
GSGKSNSASVVAEKLLDNGFGLLIVDIDGEYYGLKEEYEILHAGADDECDIQVTTDHAEK
LAALALEQNVPIILDVSSYLDEEKAREVLTAVARQLFAKAKKFKQPFLLLVEEIHEYIPE
KGGVDECGKMLIKIGKRGRKHGLGIVGISQRPADVKKDFITQCDWLVWHRLTWNNDTKVV
SRILDGQYADAVEDLADGEAFLMTDWAEAVERVQFYRKQTFDAGATPGLDDFERPDLKSV
SDDLVSELQSITDERQETEDRIAELREELDRKNSRIAELERELQDARDMSRMADQFVDAL
VEHVDGANPGRTEQAKLRESHARTQDQTASDTDDGQATFGPDVATADGSGTAASDAAGGN
GTEEAVAEAFESFGDFVPAEASVESTPIADATDTVLENGDSAGDDQADANEGDTPANPEV
SIDEVPDFVGRLRAEVRSLEPKTQKMLSYYREQGPASPLDAHFVAGGSGDRTHAYARNRS
LRTAELIEHVGQGAYDYRLPDLLEERAERAPEDVDDEGLDAYVDVIEATVDEF
Download sequence
Identical sequences S6CVQ5
gi|529078940|ref|YP_008377943.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]