SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154685105|ref|YP_001420266.1| from Bacillus amyloliquefaciens FZB42

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|154685105|ref|YP_001420266.1|
Domain Number - Region: 34-61
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0549
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154685105|ref|YP_001420266.1|
Sequence length 190
Comment hypothetical protein RBAM_006500 [Bacillus amyloliquefaciens FZB42]
Sequence
MIQLKNLYKAVVVILISACFLLFNGWYFHKCIIDPHYYQLTDFSEEDIQIFEHFYNIDLP
SNTKFIKAEQFETGIGNYSAILYVSLPAKKVKPLVSDYSYMPIFYNNRYTVFYGVNITSS
NKETAQITFGADDGSLNGSLWSKQVRNLLESKGKYIGVSDETYVISAFIINIVFIALLVW
ILKKGRRTRV
Download sequence
Identical sequences A7Z209
326423.RBAM_006500 gi|154685105|ref|YP_001420266.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]