SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154686314|ref|YP_001421475.1| from Bacillus amyloliquefaciens FZB42

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154686314|ref|YP_001421475.1|
Domain Number 1 Region: 6-151
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 8.11e-35
Family SMI1/KNR4-like 0.00000586
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154686314|ref|YP_001421475.1|
Sequence length 154
Comment hypothetical protein RBAM_018820 [Bacillus amyloliquefaciens FZB42]
Sequence
MDFYLKVKEFIADNAKEKDFTGGIGEDKILKIEQDLQVTLPDSYKWFLRKYGSGGVYGID
LLGYDFGGASVVETTREYHEYRGLPSGLVVIEHVDFFGYCLDTNKINSEGECPVVIWSEF
GGYKELNSAHFIKFFYERLHEMKENWEEDADWDD
Download sequence
Identical sequences A7Z5G8
WP_012117732.1.37657 WP_012117732.1.44318 WP_012117732.1.80280 326423.RBAM_018820 gi|154686314|ref|YP_001421475.1| gi|556557679|ref|YP_008727214.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]