SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154688024|ref|YP_001423185.1| from Bacillus amyloliquefaciens FZB42

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154688024|ref|YP_001423185.1|
Domain Number 1 Region: 2-119
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 9.29e-25
Family SMI1/KNR4-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154688024|ref|YP_001423185.1|
Sequence length 121
Comment hypothetical protein RBAM_036250 [Bacillus amyloliquefaciens FZB42]
Sequence
MTEEEFRAAEKSLRASFPKAYKRLLHKKNPAEIGEWIFSPIREQSRLQKTWDDVIRQNSV
CREESMPDDLIVIADNGTGDKLCLKKTDSVMEETVYLWDHETADVELYAASIGEFIENEK
E
Download sequence
Identical sequences A7ZAC8
326423.RBAM_036250 WP_012118804.1.37657 WP_012118804.1.44318 WP_012118804.1.80280 gi|154688024|ref|YP_001423185.1| gi|556559525|ref|YP_008729060.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]