SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119776538|ref|YP_929278.1| from Shewanella amazonensis SB2B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119776538|ref|YP_929278.1|
Domain Number 1 Region: 33-104
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.00000105
Family Coronavirus S2 glycoprotein 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119776538|ref|YP_929278.1|
Sequence length 217
Comment hypothetical protein Sama_3406 [Shewanella amazonensis SB2B]
Sequence
MKQLLSLALLGSALLLGGCQSAYYGAMEKVGYHKRDIMVDRVKDAKESQEEAQQQFSSAL
EEMQALLNHDGGDLEKAYNKAKDEYDSAQSAADDVSNRIDKVEDVAEALFDEWQAEIAEI
SKASLRSKSQSKLKETRRNYESLMRSMRRAESKMPPILTSMKDNMLYLKHNLNAQTIGAI
KGEFTSLKTDITGLIKEMNRSIAESNKFIAAMEAAGQ
Download sequence
Identical sequences A1SB52
WP_011761513.1.25267 326297.Sama_3406 gi|119776538|ref|YP_929278.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]