SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|338729821|ref|YP_004659213.1| from Thermotoga thermarum DSM 5069

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338729821|ref|YP_004659213.1|
Domain Number 1 Region: 275-538
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.72e-66
Family Tandem AAA-ATPase domain 0.0000000115
Further Details:      
 
Domain Number 2 Region: 103-270
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.13e-45
Family RecG "wedge" domain 0.00000857
Further Details:      
 
Domain Number 3 Region: 477-689
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.38e-43
Family Tandem AAA-ATPase domain 0.00000171
Further Details:      
 
Domain Number 4 Region: 1-95
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 3.79e-18
Family RecG, N-terminal domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|338729821|ref|YP_004659213.1|
Sequence length 779
Comment ATP-dependent DNA helicase RecG [Thermotoga thermarum DSM 5069]
Sequence
MRPLLVEEFLEEFETVIKKVQNKELSVKDLENFIGSKLNLIHDPLLELEPVAQERFNQMI
DYAKPIASLPPERAAVRLKNLLSMVEKYRNWFLINCPVFEETKDPDTPIKYAKQVGPKRE
KLLAKLEIKTLKDLVWYVPRDYEDRRKIVPIKDIRGDEKVTTLAKIINVETKQTFSMPIT
VAVAADGINQVLLKWFNQEYMQKVLETLKGKEVYITGVVKRGTFGSLEFTNPEVEPKGDT
QVLEILPVYSLTEGLSQKQMRNIVKENITSIKIKETLPEWLIQERKLLDIKTALYGIHFP
KSMYHLKKSIERLAYEELLILQLAFLLSKQTIERIGGISKNIKGELAEKFIASLPFKLTN
AQIKAHQEIREDMQSEKPMSRLLQGDVGSGKTVVAQLAVIDNFEAGYQAAIMAPTSILAI
QHYRRMAPAFEKLGIKTALLLGETSPREKEKIKSFLKTGQIDVIIGTHTLIQEDVEFANL
GLVIIDEQHRFGVRQREALISKGKVVDVLVMTATPIPRTLAMTIYGDLDISIIDELPPGR
KLPKTILISASKIDQVYDFVKNEVKNGGQAYIVYPLIDESDKVQAKAATQMFEHLAYEVF
KDFKVGLLHGRMSQIEKDRIMESFANREIEILVSTTVIEVGIDVPGATVMVIENPERFGL
AQLHQLRGRVGRSEKQGYCFLVVGNVDEETLERLRYFAMSKDGFEVAEYDLKLRGPGEFL
GLRQHGLPDLRIADLTRDRDLLILARKDAEKLLTKREENKELFERVERLYGERLKLVKV
Download sequence
Identical sequences F7YTD9
WP_013931341.1.44118 gi|338729821|ref|YP_004659213.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]