SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153934787|ref|YP_001388747.1| from Clostridium botulinum A str. Hall

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153934787|ref|YP_001388747.1|
Domain Number 1 Region: 11-196
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.09e-25
Family Clostridium neurotoxins, the second last domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153934787|ref|YP_001388747.1|
Sequence length 332
Comment hypothetical protein CLC_2917 [Clostridium botulinum A str. Hall]
Sequence
MKKGIMKMPNNYSLNLNGTGYISVDNFPSFGNEYTLKIYICKKYNEFQKWTGVLMRGDSD
TSQGIYIQDDNTLCFTNSKSGRVILDDMKNYNINEWNCITITHNNKTLKYYRNGKLIKIL
QNLRSINSKEQLFIGYWDRFCKFNGNIAEIAIWNTCLNDKQVLNSYNKKLTGEESNLVAY
WRINEGKGDIIYDLSNNKFNGNVINSEWEVTAPAITCNKYLLKQNNNYYSINNNYIDLGE
IDNNKELNNLINEYGYNDLSILTKELNTKKVPAKLENDYYKSFDIDLNDIKDVINLIEEN
DKKCIEYSCNNYKISDKVKEINDGKFEVLMKE
Download sequence
Identical sequences A0A0M1L1L1
441770.CLB_3045 441771.CLC_2917 WP_012099495.1.10598 WP_012099495.1.27088 WP_012099495.1.28409 WP_012099495.1.34822 WP_012099495.1.46754 WP_012099495.1.63111 WP_012099495.1.63218 WP_012099495.1.65258 WP_012099495.1.75721 YP_001388747.1.17653 gi|153934787|ref|YP_001388747.1| gi|153930930|ref|YP_001385339.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]