SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150019944|ref|YP_001305298.1| from Thermosipho melanesiensis BI429

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150019944|ref|YP_001305298.1|
Domain Number 1 Region: 268-530
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.72e-60
Family Tandem AAA-ATPase domain 0.0000000242
Further Details:      
 
Domain Number 2 Region: 94-265
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.25e-47
Family RecG "wedge" domain 0.0000111
Further Details:      
 
Domain Number 3 Region: 470-679
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.48e-42
Family Tandem AAA-ATPase domain 0.00000166
Further Details:      
 
Domain Number 4 Region: 1-90
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 2.62e-36
Family RecG, N-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150019944|ref|YP_001305298.1|
Sequence length 773
Comment ATP-dependent DNA helicase RecG [Thermosipho melanesiensis BI429]
Sequence
MYIPLLIEDFLEKVERIKDSFELIEFFEENFEKIDDPLKNIPEVSKRLQEFYDYIVKMKH
LNRERIEKRMKFIPGMVKRFRDMYLVYKAEKQGNLKELDLSVKYLKGVGPKRAEKLMKLG
VKTVEDLLNYFPRDYEDRRKVMPLPILKEDEKVVTSGVLSAVEKIKKSGLSIVSAVLSDG
MYQILLKWFNQDYIGNVLKTLMRKKVYVFGLVKKGFYGTLEIHNPEIEVIGNSSREIMPV
YSLTEGIKQNVIRRIIKENLYNIYNFKDYLPDELKGKRRLLDVYQAYTGMHFPLSMYHQK
MSRFRLAYEEILYLQLAFFLSKKENENIGGISKNFEGKLSSELLKQLPFKLTNAQLNAYE
EIKKDLKSDKPMNRLLQGDVGSGKTIVSELAILDNYEAGFQSAVMVPTSILAIQNFKKMF
EHLSRFGIRVALLLGATSTTEKNRIKQMLKNGDLDVVVGTHALIQEDVHFKNLGLVVIDE
QHRFGVRQRKELIAKGKLVDTLVMTATPIPRTLSLSVYGDLDVSIIDEMPKGRKPIKTFV
VHQTKIDEVYKFIISEVENGGQAYIVYPLIDDSEKLSVKSAVSMHEKLREEYFKDISTAL
IHGRMSDFEKDEIMYKFSRGEIKILISTSVIEVGIDVPQATVIVIENAERFGLAQLHQLR
GRVGRGNKQSYCYLTVGNVSRETLERLNFFASTNDGFKISEYDLKLRGPGEFLGVKQHGL
PEFKVADIINDIDIILMAREDAKYIVNNIEKFKTLIEYVKDIYKERLEFLDVG
Download sequence
Identical sequences A6LJ12
gi|150019944|ref|YP_001305298.1| WP_012056275.1.25510 WP_012056275.1.29063 WP_012056275.1.34498 WP_012056275.1.43064 WP_012056275.1.53857 WP_012056275.1.82961 WP_012056275.1.85686 391009.Tmel_0034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]