SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|549688277|ref|YP_008620009.1| from Vibrio nigripulchritudo VibrioScope

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549688277|ref|YP_008620009.1|
Domain Number 1 Region: 2-116
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.11e-35
Family ArsC-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|549688277|ref|YP_008620009.1|
Sequence length 116
Comment putative Arsenate reductase [Vibrio nigripulchritudo]
Sequence
MSVTIYHNPRCSKSRQTLALLEEKGITPDVVKYLDADLTVEQLKTVFAQLGLDSVRKMMR
TKEDIYKALNLGDTSVTDEQLFEAMVANPKLIERPIVINGDAARLGRPPEQVLEIL
Download sequence
Identical sequences U4JVI0
WP_022549948.1.100974 WP_022549948.1.41471 WP_022549948.1.79392 WP_022549948.1.83433 WP_022549948.1.85604 WP_022549948.1.99411 gi|549688277|ref|YP_008620009.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]