SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|549688287|ref|YP_008620019.1| from Vibrio nigripulchritudo VibrioScope

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549688287|ref|YP_008620019.1|
Domain Number 1 Region: 4-114
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.77e-36
Family ArsC-like 0.0000802
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|549688287|ref|YP_008620019.1|
Sequence length 115
Comment putative Arsenate reductase [Vibrio nigripulchritudo]
Sequence
MANIMYGIPNCDTIKKAKKWLDAENIAYEFHDYRKQGIDKSMVETFCQQLGWEQVLNKRG
TTFRQLSQEQKDSLNEQSAIELLVEHPAMIKRPILLVEDAYHIGFKADQYQDIFK
Download sequence
Identical sequences U4DS31 U4JVJ0
WP_022549956.1.100974 WP_022549956.1.101053 WP_022549956.1.17125 WP_022549956.1.41471 WP_022549956.1.5221 WP_022549956.1.70175 WP_022549956.1.77049 WP_022549956.1.79392 WP_022549956.1.83433 WP_022549956.1.83782 WP_022549956.1.85604 WP_022549956.1.98144 WP_022549956.1.98804 WP_022549956.1.99411 gi|549688287|ref|YP_008620019.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]