SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|549690044|ref|YP_008621776.1| from Vibrio nigripulchritudo VibrioScope

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549690044|ref|YP_008621776.1|
Domain Number 1 Region: 5-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.92e-29
Family Selenoprotein W-related 0.0000665
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|549690044|ref|YP_008621776.1|
Sequence length 92
Comment putative selenoprotein W-related protein [Vibrio nigripulchritudo]
Sequence
MEKAIIDIYYCRQCNWMLRSAWLSQELLHTFSEEIETVSLHPNTGGRFEIHCNGVLIWER
KRDGGFPEAKVLKQKVRDVIDPERDLGHSDSK
Download sequence
Identical sequences U4K7T6
gi|549690044|ref|YP_008621776.1| WP_022551354.1.100974 WP_022551354.1.41471 WP_022551354.1.79392 WP_022551354.1.83433 WP_022551354.1.85604 WP_022551354.1.99411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]