SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|549691114|ref|YP_008622846.1| from Vibrio nigripulchritudo VibrioScope

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549691114|ref|YP_008622846.1|
Domain Number 1 Region: 3-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.79e-39
Family Thioltransferase 0.0000366
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|549691114|ref|YP_008622846.1|
Sequence length 108
Comment thioredoxin 1 [Vibrio nigripulchritudo]
Sequence
MSDKILQLTDDGFEDDVIKAAGPVLVDFWAEWCGPCKMIAPILDEIAEEYEGKLTIGKLN
IDQNADTPPKFGIRGIPTLLLFKDGNVAATKVGALSKTQLKEFLDANI
Download sequence
Identical sequences U4E8V5 U4KHQ4
WP_004399141.1.100974 WP_004399141.1.101053 WP_004399141.1.17125 WP_004399141.1.26019 WP_004399141.1.41471 WP_004399141.1.5221 WP_004399141.1.69985 WP_004399141.1.70175 WP_004399141.1.74145 WP_004399141.1.77049 WP_004399141.1.79392 WP_004399141.1.83433 WP_004399141.1.83782 WP_004399141.1.85604 WP_004399141.1.98144 WP_004399141.1.98804 WP_004399141.1.99411 gi|549691114|ref|YP_008622846.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]