SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|549718775|ref|YP_008641408.1| from Vibrio nigripulchritudo VibrioScope

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549718775|ref|YP_008641408.1|
Domain Number 1 Region: 1-156
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.34e-34
Family Glutathione peroxidase-like 0.0000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|549718775|ref|YP_008641408.1|
Sequence length 157
Comment Type 2 peroxiredoxin [Vibrio nigripulchritudo]
Sequence
MIEQGQKLPAGSLSELTADGMTNHDVAELFAGKKVVLFAVPGAFTPTCSEAHLPGYVVLA
DQLKAKGVDLIACVSVNDAFVMKSWGDAQNASEIKMLADGDASFTKALGLEMDTESFGGV
RSQRYAMIIEDGVVTTLNVEPPKTFEGSKAETILASL
Download sequence
Identical sequences U4KBY8
gi|549718775|ref|YP_008641408.1| WP_022560969.1.100974 WP_022560969.1.101053 WP_022560969.1.17125 WP_022560969.1.41471 WP_022560969.1.69985 WP_022560969.1.74145 WP_022560969.1.79392 WP_022560969.1.83433 WP_022560969.1.85604 WP_022560969.1.98804 WP_022560969.1.99411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]