SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|549719112|ref|YP_008641745.1| from Vibrio nigripulchritudo VibrioScope

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549719112|ref|YP_008641745.1|
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.84e-26
Family Thioltransferase 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|549719112|ref|YP_008641745.1|
Sequence length 92
Comment Glutaredoxin-3 [Vibrio nigripulchritudo]
Sequence
MAKIEIYTKHYCPHCKAAKHTLKRLGLTYREIEVSDNPTRLNEMKNRSQRRTVPQIFVGD
HHVGGNDDLVASIRSGNFEQILERQGITHNAK
Download sequence
Identical sequences U4E9L8 U4KIH4
WP_022561263.1.100974 WP_022561263.1.41471 WP_022561263.1.70175 WP_022561263.1.77049 WP_022561263.1.79392 WP_022561263.1.83433 WP_022561263.1.83782 WP_022561263.1.85604 WP_022561263.1.98144 WP_022561263.1.99411 gi|549719112|ref|YP_008641745.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]