SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|549719913|ref|YP_008642546.1| from Vibrio nigripulchritudo VibrioScope

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549719913|ref|YP_008642546.1|
Domain Number 1 Region: 1-43
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000927
Family Glutathione peroxidase-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|549719913|ref|YP_008642546.1|
Sequence length 129
Comment Putative thiol-disulphide oxidoreductase DCC [Vibrio nigripulchritudo]
Sequence
MTLTIFYDGTCPLCKAEMNQLKNFDTHQKLKLVDIYQPQFSEQYPQIDVASANRILHAID
GNGNLLLGLDVTQAAWNAVERKPWVNWLRKPGIRVVADWAYLRFAKHRYTISWLLTGKRR
SNCEQCRLP
Download sequence
Identical sequences U4KHR8
WP_022561913.1.100974 WP_022561913.1.41471 WP_022561913.1.5221 WP_022561913.1.79392 WP_022561913.1.83433 WP_022561913.1.85604 WP_022561913.1.99411 gi|549719913|ref|YP_008642546.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]