SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|549719972|ref|YP_008642605.1| from Vibrio nigripulchritudo VibrioScope

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549719972|ref|YP_008642605.1|
Domain Number 1 Region: 35-154
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.21e-23
Family Glutathione peroxidase-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|549719972|ref|YP_008642605.1|
Sequence length 161
Comment putative Thioredoxin family protein [Vibrio nigripulchritudo]
Sequence
MFKIIRNLTGYLLLIVLITGLLDWWRTKHVDFYDMPETRGMTIDGTYVDLKELSKEKPVL
VYFWATWCGVCTLTSPTIDLLSGHYEVVSIALASGEDERLQEYMTHKNYDFKVINDLKGS
INQYWRAQVTPTIAIVKDGEIHSMTTGFSTPWGLWLRLLLA
Download sequence
Identical sequences U4EF11 U4KEN4
WP_004402844.1.100974 WP_004402844.1.26019 WP_004402844.1.41471 WP_004402844.1.5221 WP_004402844.1.69985 WP_004402844.1.70175 WP_004402844.1.77049 WP_004402844.1.79392 WP_004402844.1.83433 WP_004402844.1.83782 WP_004402844.1.85604 WP_004402844.1.98144 WP_004402844.1.99411 gi|549719972|ref|YP_008642605.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]